LL-37 5mg – Research Peptide
LL-37 5mg Peptide is a synthetic peptide associated with the human cathelicidin antimicrobial protein hCAP-18. Also known as CAP-18-related peptide, LL-37 belongs to the cathelicidin family and is studied in laboratory research involving antimicrobial peptides, innate immune signalling, and peptide–cell interactions.
Bluewell Peptides reports an HPLC purity of greater than 99.1%; researchers should consult the relevant batch documentation to confirm the reported result.
A Certificate of Analysis (COA) is stated to accompany each batch. Review the available documentation to assess the analytical methods, batch identity, and reported quality-control results.
What Is LL-37?
It is an important subject of scientific investigation because of its interactions with microbial membranes, host cells, and immune-related signalling pathways.
Research involving LL-37 may examine peptide structure, membrane interactions, cellular responses, and mechanisms associated with innate immunity. Findings depend on the experimental model and conditions; laboratory research alone does not establish clinical safety or effectiveness.
LL-37 5mg – Product Specifications
| Specification | Details |
|---|---|
| Product name | LL-37 5mg |
| Catalogue number | BWP-LL37-5 |
| CAS number | 154947-66-7 — verify against supplier documentation |
| Molecular formula | C₂₀₃H₃₄₅N₆₁O₄₉S — verify against the documented peptide form |
| Molecular weight | 4493.34 g/mol — verify against reference or batch documentation |
| Peptide sequence | [LL-37, 37 aa] |
| Physical form | Lyophilised solid |
| Unit size | 5mg |
| Reported purity | Greater than 99.1%, HPLC-tested as stated by the supplier |
| Batch documentation | COA availability and contents should be confirmed |
| Storage | Follow the product label and validated supplier guidance; verify the stated −20°C condition |
Quality note: HPLC purity is an analytical result, not proof of every aspect of product quality. It does not, by itself, confirm identity, sterility, endotoxin levels, or suitability for a specific experimental application.
Laboratory Handling and Storage
LL-37 is supplied in lyophilised form. Its storage, preparation, and handling should follow the product-specific documentation and the laboratory’s established procedures.
Researchers should:
- Review the product label and batch-specific COA before use.
- Follow documented storage conditions and protect the material from conditions that may affect stability.
- Select solvents and sample-preparation methods based on validated compatibility with the intended research procedure.
- Maintain records of batch identifiers, handling conditions, and relevant analytical results.This listing does not provide instructions for human or veterinary administration.
Why Choose Bluewell Peptides?
Bluewell Peptides aims to provide research-focused product information to support informed laboratory purchasing.
- Purity information: Review the supplier-reported HPLC result and the corresponding analytical documentation.
- Batch traceability: Check the batch identifier and associated quality-control records.
- Product specifications: Consult the stated sequence and other technical identifiers, subject to verification.
- Research-focused support: Contact the supplier with questions about documentation and product handling.
- Ordering information: Review current delivery terms, customer support details, and applicable purchasing policies before ordering.
Frequently Asked Questions
What is LL-37 5mg?
LL-37 5mg is a synthetic, 37-amino-acid peptide associated with the human cathelicidin antimicrobial protein hCAP-18.
What is LL-37 studied for?
The relevance of any finding depends on the specific experimental model and supporting evidence.
Bluewell Peptides reports purity greater than 99.1% by HPLC. Check the batch-specific COA to confirm the result, the analytical method, and the scope of the testing performed.
Does LL-37 come with a Certificate of Analysis?
Confirm the document’s availability and review the actual batch-specific results before relying on that claim.
The supplied specifications state storage at −20°C, protected from light. Confirm these conditions against the current product label and product-specific stability documentation.
Order LL-37 5mg from Bluewell Peptides
LL-37 5mg is a research peptide for laboratory investigations involving cathelicidin-derived peptides and related biological systems. Before purchasing, review the product specifications and available batch documentation to determine whether the material meets your laboratory’s requirements.
Users are responsible for complying with applicable laws, regulations, and laboratory safety requirements.
